PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009804066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 524aa    MW: 58178.4 Da    PI: 5.0503
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009804066.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS417.41.2e-1271555242374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +elLl+cAeavs+  + +a+ l++ l++ +s +g+pmqRl ay++e+++arl++s+s +yk+l+++e +    se l++++++++++P++kf++ 
  XP_009804066.1 155 KELLLACAEAVSDAYFPAAEVLMNVLEQKVSISGEPMQRLSAYMLEGIRARLFSSGSIIYKKLKCKEPT---NSELLSYMQVLYHICPYYKFAYT 246
                     689*****************************************************************9...89********************* PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN  I ea+ +e+ +HiiDf+i qG QW+ L+q+La Rp+gpps+RiTgv++++s   +   l+ +ge+Lak+Ae+++vpfefn+ +a + +++
  XP_009804066.1 247 SANVVIDEAMTNENGIHIIDFQIAQGSQWMFLIQSLARRPGGPPSVRITGVDDSQSAhaRGGGLQLVGEKLAKVAESCRVPFEFNA-AAISGSEV 340
                     *****************************************************9988889999***********************.8999**** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ele+L +++gEalaVn+ + lh+++desvs+ ++rd++L+lvkslsPk+v++veqe+++n++ F  rf e+l+yy+a+f+s++a+ pr++++ri+
  XP_009804066.1 341 ELENLYIRHGEALAVNFPYILHHMPDESVSTVNHRDRLLRLVKSLSPKIVTLVEQESNTNTAAFIPRFRETLDYYTAMFESIDAGRPRDDKQRIS 435
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      E+++++r++vn++acega+r+erhe ++kW++rl++aGF+p pls ++ + ++ +l+ ++s+ yr+ e++g+l+lgWk+r+L ++SaWr
  XP_009804066.1 436 AEEHCVARDVVNIIACEGADRVERHELFGKWSMRLKMAGFTPCPLSPSVGEAINDMLKDYSSN-YRIAENKGALYLGWKNRALATTSAWR 524
                     *************************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.411128505IPR005202Transcription factor GRAS
PfamPF035144.2E-125155524IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MQASQRPMEK VEQYYSPYYV FNNNSNDTSS SGTQFSFQSQ NEQFFTLDSL PAAGYVIYDS  60
PPAVSVSSNW SPFSPQYSQS TISDQHHSSD NTYGSPLSGC SGVDGVLSEM ANKLLGPESD  120
IDDSSSCSFN DVVSEPSSLT KWNRVLEIAS SLDVKELLLA CAEAVSDAYF PAAEVLMNVL  180
EQKVSISGEP MQRLSAYMLE GIRARLFSSG SIIYKKLKCK EPTNSELLSY MQVLYHICPY  240
YKFAYTSANV VIDEAMTNEN GIHIIDFQIA QGSQWMFLIQ SLARRPGGPP SVRITGVDDS  300
QSAHARGGGL QLVGEKLAKV AESCRVPFEF NAAAISGSEV ELENLYIRHG EALAVNFPYI  360
LHHMPDESVS TVNHRDRLLR LVKSLSPKIV TLVEQESNTN TAAFIPRFRE TLDYYTAMFE  420
SIDAGRPRDD KQRISAEEHC VARDVVNIIA CEGADRVERH ELFGKWSMRL KMAGFTPCPL  480
SPSVGEAIND MLKDYSSNYR IAENKGALYL GWKNRALATT SAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-541585248375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804066.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_009804067.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLM1AFN30.0M1AFN3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000217480.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13